The standard genetic code · the human insulin B chain
801,543,976,648,704ways to write the same chain
Under the standard genetic code, every one of these 90-nucleotide RNA sequences translates into the same order of 30 amino acids. Choose different synonymous codons and watch the message change while the chain remains fixed.
Rewrite the message
Each station pairs one amino acid with one of its synonymous codons. Press a codon to move to the next valid spelling, or rewrite the entire tape.
messenger RNA · generated example
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Encoding 1 of 801,543,976,648,704
No codons changed; the protein sequence is stable.
This is a combinatorial count: every synonymous codon enters once. Natural frequencies and biological effects depend on context.
2¹⁴ × 4¹⁰ × 6⁶
Thirty choices produce a 15-digit number
In this chain, 14 positions have 2 synonymous codons, 10 have 4, and 6 have 6. The choices are independent in this count, so the total is their product.
2¹⁴ × 4¹⁰ × 6⁶ = 801,543,976,648,704
Writing one encoding each second would take about 25.4 million years.
RNA ≠ protein
The same chain can behave differently in a cell
Every encoding in the count yields the same amino-acid order under the standard code. As RNA molecules, the encodings can differ in frequency, structure and stability, while context can alter translation speed and expression level.
In the body, the mature B chain is not translated separately; it results from preproinsulin processing. This page isolates the 30-amino-acid segment to make the redundancy of the genetic code visible.
P01308 · transl_table=1
Method and sources
The calculation starts with the human insulin B chain in UniProt P01308, positions 25–54. For each amino acid, it counts the synonymous codons in NCBI translation table 1 and multiplies the 30 values. Start and stop codons, untranslated regions and biological constraints around the segment are excluded.
- UniProtKB P01308, reviewed human insulin entry: the B chain at positions 25–54 and the 110-amino-acid protein sequence.
- NCBI translation table 1, the standard genetic code and its 64 codons.
- Liu, Yang and Zhao, “Synonymous but Not Silent,” Annual Review of Biochemistry, 2021, on how codon choice can affect expression and protein folding.
Sources accessed 20 August 2026.
The codons change while the chain remains.